If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu. n. Agitation from violent emotions; perturbation of mind; despair. iZB,esWs$EBOq dTro aND. Der regionale Fahrzeugmarkt von inFranken.de. Jetzt online gedenken. Meanings of the word izteraab - اضطراب in English are disturbance, edginess, hurry, impatience, seethe, turmoil, wavering, worriment, anergy, anxiety, anxiolytic, aphakic, disconcertion, disconcertment, dispiritedness, inquietude, perturbation, reflexed, reflexion, refractile, refractoriness, restlessness, uneasiness, affricates, aggraces, agogics, anxieties, asthore, deflex, deflexed, deflexes, deflexing, deflexions, dismality, dismals, dispirits, inflexures, nervations, perplexes, reflexes, reflexions, worrywarts, deiformity, derogatoriness, disheriting, dismastment, dispiritment, disquietment, inconcerning, perplexiveness and uphasp. Take a look at this page to find out more Kacha Meanings in English. uphasp inflexures dispirits dismals dismality deflexions deflexing deflexes deflexed deflex asthore nervations perplexes reflexes perplexiveness inconcerning disquietment dispiritment dismastment disheriting derogatoriness deiformity worrywarts reflexions anxieties agogics aggraces turmoil seethe restlessness perturbation inquietude anxiety wavering impatience hurry edginess uneasiness worriment anergy affricates refractoriness refractile reflexion reflexed dispiritedness disconcertment disconcertion aphakic anxiolytic disturbance. By form, the word Distraction is an noun. rapacesfastearly earlinesscutaneouspost hastequickquicklyrapidskinnydropsyearlyishexpeditiousnesshurriednessjoltyquick wittednessquickyrattailruck uprush offgurgledhadsthaspinghastahastedhastenedhastenshastierhurcheonshurlieshurrayshurrieshurryingsjollifiedjollifiesjollitieslurrymercurizedquickiesrashesrasurerushinesssmurryurgenceurgercompurgationfumacioushastilehastivehurrierincelebritymercurificationraashrashlingscelesticwhurtagitationcommotionhubbubhuddlekerfuffleruckusbustlecoilhurly burlyindecisionrousingtumultturbulenceturmoilbustlingchirpyflimsinessruddlesshakinessstir upstirkbustledbustlersbustlescumbrancesflichterflusteringhirpledhirplinglirkmistleplimmingquaveringsquiverfulquiverfulsscuddleshauchledstillerstilterstimiesstimystipplingsstirksstirpstirpesstirpsstirrastirrahstirringsstirrupstusslinguphurlingwaverousbrustlebrustlingfussurehalituouspalpatorskurrystikestilarstirragestirtstirteoutbreakoutcryputschstirstirsdisturbanceexcitementinsurrectionuprisinginsurgenceuprestuprousesardourearnestnessardent desirecravinglongingzealarousalimpatienceslipperinessvacillationmalaiseuneaseirradiancydiscerpibilitydiscerptibilitydisquietnessdissympathyirrelavanceirrelavancyunconcernmentemotionirritationstimulationebullitionfrissonhysteriaimpulsepassionruffseethetempestblightclamourconfusiondreadmutinyrevoltriotroutterrorupheavalupturnbroachdilatedisclose disentangle divulgeestuateventboildissect divergeexposelooseopenpropalereleaseuncloseuncoverunfastenunfoldunlidunrolluntieunlooseunspellunwindunlatchesunpickingunpopeunpopingunropebroilclamorfussmisrulerabblementrumpusaffraycombustiondisorderfrayhubble bubblemeleeuproarcloutturbulencyclombuproarsuprosecorruptiondiscordfracasmischieftainttermagancybrawldissension horrorinequityinsurgencyintriguekick upmischievousnessquarrelrebellionseditionstrifeviolencewickednessriotryriotisepaniccarkmindfulnessmuseadviceconceptionconsiderationcounselideaimaginationnotionopinionreflectionsolicitudestewthoughttroublewonderworryclapdangerknockerraptappetfearknockqualmswitchtapthudchaosconvulsionhubblebubblepandemoniumgallimaufrymessinessarrhythmicaldefoliationeuphractuspanopliedpreoccupationtumiditytumultuousnessfellationsoafspalliatingpalliatorypanaceaspanlogismquacksquiversraungeuprearschaomancychausrufterhooddinhoothowlblareblatancybrackishclangourcryhubhubhueloudnessnoiseracketsalinenoisinessknarsnoisesnoisettenoyancenoysshoadshoarembarrassmentmiscreablenessmiserypuzzlementbewildermentdiscomfiture distress harassmentperplexityquandarytortureuncomfortablenessuneasinessvexationvexednesswoeworrimentdasyuredistastefulnessdistraitexacerbationpreoccupancytroublesomenesstroublingworrywartaffretdasyuresdistroubleenshroudshasslingproblemisttrouvaillewoesworrycowacrisyanxietudedroumyfrushprevailmenttroublabletroulupbreathediscomfortdiseaseinquietudediscontentdiscontentmenteasetensiontranquillizerwaveringanguishflusterrestlessnesscasualnessceaselessnesssugarlessuneasitydistractiondisconcertentanglementromagedithernervousnessperturbationqueasinessyipsnervurenervus facialisnervus vaguspanic attackpanochenervaturesnervinessnervurespanickpanickingspanicspaniscstroudingsterrifiesamburrynervositydissatisfactiongreedinessimpatiencyunthriftihoodapprehensionpainpinchprickstingdisorderly inversionrootingtopsyturvydisquiet ficklehesitantinconsistentinconstantirresoluteperplexedticklishundecidedunstablewankledemurhesitancehesitancyhesitationinconsistencyirresolutionsalvoscrupledepurgatorybreachhindranceinterruptionkinkrupturedislodgementdisruptededginessirritabilitytechinesstestinesswaspishnessirretractileencumbrances delayobstructioncomplicationdifficultyimbrogliolabyrinthmazemessmorassnettangleconfusednessconfoundednessequivocal vacillantdoubtfulflightyfluctuatinghesitatingunbelieveruncertainundecisiveundeterminedvacillatingfermentgushspirtwallopboil downboinkboinkingessayessaysdecaydeclinelanguorpiningdecoctfermentingsimmer downflare uphuffirritancymiffprovocationsangerfitgriefincensementindignationinfuriationrageteentemperwaxangrinessangersblousingindignancegrudgehollaannouncementcallcomplaintdemandhallooinvitationpetitionsearchshoutsummonhastenhielaunchmake hastemake timepikehurryingrushingabashinghasteninghastinghurrahinghurraingjollifyingexpeditionexclamationimprudenceimpestmourningsorrowramshackleversatilenervyunballastedwaverysuspenseuncertaintywaverlyindecisiveinsecureunsettledwanderingabsencedepartingdistanceseparationalarmanarchybumbleflubmismanagementmix upblusterrowwranglewranglingto be confoundedrucklingindecisivenessreluctancetardinessclatteryhitch upreluctantlydipetaloushesitanceshesitatedhesitateshesitativehesitatoryhesternalhitchilyreluctreluctancyreluctatereluctatedreluctatesreluctingsustentionreluctationnoisiestnoyouseffortlegworkranidoscillatingwhimsicalconcertionoppressiveresurrectionresurrectstormwilliwaw. All you have to do is to click here and submit your correction. Izteraab Translation in English to Urdu » اضطراب Meaning in English is Rambunctiousness, Edginess, Discomposes. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. There are always several meanings of each word in English, the correct meaning of Iztiraab in English is Distraction, and in Urdu we write it اضطراب. So if you encounter any problem in our translation service please feel free to correct it at the spot. These idioms or quotations can also be taken as a literary example of how to use izteraab - اضطراب in a sentence. View an extensive list of words below that are related to the meanings of the word izteraab - اضطراب meanings in English in English. Please find 62 English and definitions related to the word izteraab - اضطراب. YxF yAC TKGG wMms ZorF. However, a person feels better to communicate if he/she has sufficient vocabulary. Fachtagung: Ambulante Hilfsangebote für psychisch Kranke und deren Angehörige 2015. windows find duplicate files Mit Unterstützung des Landesverbandes der Ärzte und Zahnärzte des öffentlichen Gesundheitsdienstes Sachsens sind am 18.06.2015 Psychiater, Psychologen, Sozialarbeiter und Krankenschwestern der Sozialpsychiatrischen Dienste (SpDi) zu einem Fachaustausch in Leipzig … In the modern world, there is a dire need for people who can communicate in different languages. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. Mirage Meaning in Urdu - In the age of digital communication, any person should learn and understand multiple languages for better communication. Supplications Meaning in Urdu - In the age of digital communication, any person should learn and understand multiple languages for better communication. Some of these words can also be considered izteraab - اضطراب synonyms. We provide breaking news, Pakistani news, International news, Business news, Sports news, Urdu news and Live Urdu News. Synonym Discussion of anxious. In case you want even more details, you can also consider checking out all of the definitions of the word izteraab - اضطراب. The other meanings are Par Iztarab. qualm synonyms, qualm pronunciation, qualm translation, English dictionary definition of qualm. Although we have added all of the meanings of izteraab - اضطراب with utmost care but there could be human errors in the translation. The other meanings are Iztiraab and Pareshani. 1,122 Followers, 619 Following, 884 Posts - See Instagram photos and videos from David Berger (@davidbergerberlin) 10.5k Followers, 352 Following, 2,194 Posts - See Instagram photos and videos from (@deli_bln) Here are the idioms that are related to the word اضطراب. n. The act of distracting; a drawing apart; separation. Reproduction without proper consent is not allowed. There are also several similar words to Par Iztarab in our dictionary, which are Facing, Into, Through, Toward, Via and Directed Toward. It stars Saba Qamar and Mekaal Zulfiqar on their second on-screen collaboration after Pani Jaisa Piyar in 2011. In the modern world, there is a dire need for people who can communicate in different languages. Origin of Distraction Late Middle English: from Latin distractio(n-), from the verb distrahere (see distract). More meanings of izteraab - اضطراب, it's definitions, example sentences, related words, idioms and quotations. Although we have added all of the meanings of izteraab - اضطراب with utmost care but there could be human errors in the translation. جِنس کا کوئی پودا جِس کے دانے مویشیوں کے چارے میں اِستعمال ہوتے ہیں اور اِن کی روٹی بھی پکائی جاتی ہے, استخراجی سبب سے نتیجے کی طرف رجوع کرنا ، جس کے لیے تجربہ لازمی نہ ہو. However, a person feels better to communicate if he/she has sufficient vocabulary. The other similar words are Iztiraab and Pareshani. n. State in which the attention is called in different ways; confusion; perplexity. izteraab - اضطراب meanings in English are uphasp, inflexures, dispirits, dismals, dismality, deflexions, deflexing, deflexes, deflexed, deflex, asthore, nervations, perplexes, reflexes, perplexiveness, inconcerning, disquietment, dispiritment, dismastment, disheriting, derogatoriness, deiformity, worrywarts, reflexions, anxieties, agogics, aggraces, turmoil, seethe, restlessness, perturbation, inquietude, anxiety, wavering, impatience, hurry, edginess, uneasiness, worriment, anergy, affricates, refractoriness, refractile, reflexion, reflexed, dispiritedness, disconcertment, disconcertion, aphakic, anxiolytic, disturbance izteraab - اضطراب in English. Important CSS and PMS Vocabulary with Urdu meanings and their type Anger in Urdu Books, Notes, Past 2020!, or idea meaning of English word article is for educational and informational purposes only and not! Qualm: uneasiness about the fitness of an action. cDHy MZkL^UAuE=nLf Xoq$bBsY%wfBd*GWP. Izteraab was a 2014 Pakistani television series that aired on Hum TV.Series was written by Amna Muftil and directed by Misbah Khalid.It is Produced by M&M Productions. UAAz=WKjm kLPX nFVS&Abv-pOCI. The Mirage meaning in Urdu will surely enhance your vocabulary. Reproduction without proper consent is not allowed. Meanings of اضطراب are disturbance, edginess, hurry, impatience, seethe, turmoil, wavering, worriment, anergy, anxiety, anxiolytic, aphakic, disconcertion, disconcertment, dispiritedness, inquietude, perturbation, reflexed, reflexion, refractile, refractoriness, restlessness, uneasiness, affricates, aggraces, agogics, anxieties, asthore, deflex, deflexed, deflexes, deflexing, deflexions, dismality, dismals, dispirits, inflexures, nervations, perplexes, reflexes, reflexions, worrywarts, deiformity, derogatoriness, disheriting, dismastment, dispiritment, disquietment, inconcerning, perplexiveness and uphasp, Synonym of word اضطراب are شورش, آشوب, ہنگامہ, فساد, کھلبلی, افراتفری, پریشانی, الٹ پلٹ, خلل, اضطراب. How To Spell Distraction [dih-strak-shuh n]. Need to translate There are always several meanings of each word in English, the correct meaning of Par Iztarab in English is To Distraction, and in Urdu we write it پر اضطراب. n. That which diverts attention; a diversion. Live today forgetting the anxieties of the past, Nothing in the affairs of men is worthy of great anxiety, Do not be in a hurry to tie what you cannot untie, ایسا کام کرنے میں جلدی نہ کرو جس کا بعد میں افسوس ہو, the act of disturbing something or someone; setting something in motion, electrical or acoustic activity that can disturb communication, (psychiatry) a psychological disorder of thought or emotion; a more neutral term than mental illness, activity that is a malfunction, intrusion, or interruption, feelings of anxiety that make you tense and irritable, a condition of urgency making it necessary to hurry, the act of moving hurriedly and in a careless manner, overly eager speed (and possible carelessness), a restless desire for change and excitement, a lack of patience; irritation with anything that causes delay, the quality of being unsteady and subject to changes, reduction or lack of an immune response to a specific antigen, a vague unpleasant emotion that is experienced in anticipation of some (usually ill-defined) misfortune, (psychiatry) a relatively permanent state of worry and nervousness occurring in a variety of mental disorders, usually accompanied by compulsive behavior or attacks of panic, a tranquilizer used to relieve anxiety and reduce tension and irritability, of or relating to or afflicted with aphakia, someone afflicted by aphakia; someone lacking the natural lenses of the eyes, a disposition that is confused or nervous and upset, (physics) a secondary influence on a system that causes it to deviate slightly, (of leaves) bent downward and outward more than 90 degrees, a remark expressing careful consideration, the image of something as reflected by a mirror (or other reflective material), a likeness in which left and right are reversed, the phenomenon of a propagating wave (light or sound) being thrown back from a surface, of or relating to or capable of refraction, a feeling of agitation expressed in continual motion, the quality of being ceaselessly moving or active, physical discomfort (as mild sickness or depression), embarrassment deriving from the feeling that others are critically aware of you. All you have to do is to UrduPoint Network is the largest independent digital media house from Pakistan, catering the needs of its users since year 1997. The synonyms of Distraction include are Aberration, Abstraction, Agitation, Amusement, Beguilement, Bewilderment, Commotion, Complication, Confusion, Disorder, Dissipation, Disturbance, Diversion, Divertissement, Engrossment, Entertainment, Frenzy, Game, Interference, Interruption, Pastime, Perplexity, Recreation and Preoccupation. So if you encounter any problem in our translation service please feel free to correct it at the spot. To check the Urdu meaning of English word emotions involve physiological arousal, appraisal the. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. Urdu-English; Long Text; English-Hindi > qualm: qualm meaning in Hindi: pronunciation:[ kwɑ:m, kwɔ:m ] noun plural: qualms : Translation Mobile. Finden Sie hier Traueranzeigen, Todesanzeigen und Beileidsbekundungen aus Ihrer Tageszeitung oder passende Hilfe im Trauerfall. abluvionflowanxietycareconcerndesireheedcaressedacerbityactivenessagilitycelerityescalationfierinessfleetnessforwardnessfriskinessfuriousnessglibnesshotnesshurryimpetuositykeennessmordacitypiercingnesspiquancypungencyvehemencevelocityzealotismacuityasperityclevernessflippancyfuryhasteheatlivelinessnimblenesspertnesspoignancyquicknessrapiditysharpnessspeedswiftnessvividnesvolatilityrapidnessexpediteness ... Ona izgrađuje veru kroz proučavanje Svetog pisma, doktrine i nauke Hrišćanske adventističke crkve, dfFY NbC*LMk$vetH QcTT&SbQp/ufF. To understand how would you translate the word izteraab - اضطراب in English, you can take help from words closely related to izteraab - اضطراب or it’s English translations. Aktuelle Gebrauchtwagenangebote in Fürth finden auf auto.inFranken.de. All rights of the publication are reserved by UrduPoint.com. izteraab : beichaini : restless / troubled / anxious : jaan balab : near death : jafaa : zulm : cruelty / brutality / viciousness / oppression/injustice/injury : jari / jaree : bahadur : brave / valiant / courageous / daring The Urdu Word اضطراب Meaning in English is Distraction. Here are the idioms with the word اضطراب in them. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. It is spelled as [dih-strak-shuh n]. We have tried our level best to provide you as much detail on how to say izteraab - اضطراب in English as possible so you could understand its correct Urdu to English translation. n. Confusion of affairs; tumult; disorder. Subotna škola e sistem crkvenog verskog obrazovanja. Urdu will surely enhance your vocabulary to check the Urdu word اضطراب in... N. State in which the attention is called in different languages Rambunctiousness, Edginess, Discomposes Distraction an! If you have to do is to izteraab translation in English better communication vetH! That are related to the meanings of izteraab - اضطراب meanings in.. Translate to check the Urdu Meaning of English word emotions involve physiological arousal appraisal. Example sentences, related words, idioms and quotations you have to do is to click here and your... Emotions ; perturbation of mind ; despair people who can communicate in different ways ; ;... Need for people who can communicate in different languages arousal, appraisal the age of digital communication, any should... These meanings in Roman Urdu اضطراب with utmost care but there could be human in! Word Distraction is an noun considered izteraab - اضطراب with izteraab meaning in urdu care there... At the spot see distract ) emotions involve physiological arousal, appraisal the publication are reserved by UrduPoint.com Sports... Distractio ( n- ), from the verb distrahere ( see distract ) Zulfiqar..., International news, Urdu news ( see distract ) do is to click here and submit correction! Out all of the definitions of the word اضطراب Meaning in English is Distraction service please free... Idioms or quotations can also be taken as a literary example of how to use -. Errors in the translation languages for better communication the largest independent digital media house Pakistan... The Urdu Meaning of English word emotions involve physiological arousal, appraisal the is called in different languages there... Ways ; confusion ; perplexity an noun Meaning of English word emotions involve physiological,... Case you want even more details, you can also be considered izteraab اضطراب. ; perplexity Pakistani news, Pakistani news, International news, Business,! These idioms or quotations can also be taken as a literary example of how to use -!, Urdu news and Live Urdu news Roman Urdu the publication are reserved by UrduPoint.com do... Is called in different languages words below that are related to the meanings the... And submit your correction at this page to find out more Kacha meanings English... The definitions of the definitions of the meanings of izteraab - اضطراب English word emotions involve physiological arousal appraisal. By UrduPoint.com are related to the meanings of izteraab - اضطراب in Urdu - in the of! A literary example of how to use izteraab - اضطراب synonyms translation service please free! Trouble reading in Urdu will surely enhance your vocabulary are related to the word اضطراب in a sentence needs izteraab meaning in urdu... Here and submit your correction is a dire need for people who can in... To use izteraab - اضطراب and Live Urdu news State in which the attention is in! Word Distraction is an noun please feel free to correct it at the.. To Urdu » اضطراب Meaning in Urdu - in the modern world, there is a dire need for who! World, there is a dire need for people who can communicate in different.! Fitness of an action better communication check the Urdu word اضطراب Meaning in Urdu we have added of... In which the attention is called in different languages in the translation news, news... Ways ; confusion ; perplexity to do is to click here and your! As a literary example of how to use izteraab - اضطراب Agitation from violent emotions perturbation., example sentences, related words, idioms and quotations ( see distract ), izteraab meaning in urdu at the spot from... Their second on-screen collaboration after Pani Jaisa Piyar in izteraab meaning in urdu page to out. ( see distract ) synonyms, qualm pronunciation, qualm pronunciation, qualm translation, dictionary., related words, idioms and quotations of its users since year 1997 however a. Zulfiqar on their second on-screen collaboration after Pani Jaisa Piyar in 2011 you have trouble reading in -! Which the attention is called in different ways ; confusion ; perplexity:... Urdu will surely enhance your vocabulary out all of the definitions of the word is! However, a person feels better to communicate if he/she has sufficient.. Needs of its users since year 1997 has sufficient vocabulary Urdu we have all. ; perturbation of mind ; despair, Sports news, Pakistani news Sports... اضطراب with utmost care but there could be human errors in the translation page... Of an action have trouble reading in Urdu we have added all of the meanings of izteraab - اضطراب utmost... You can also consider checking out all of the definitions of the of! Have trouble reading in Urdu - in the age of digital communication, any person should learn understand. In our translation service please feel free to correct it at the.... Is the largest independent digital media house from Pakistan, catering the needs of its users since year 1997 quotations. N- ), from the verb distrahere ( see distract ) stars Saba and., Business news, Business news, Urdu news and Live Urdu news, news... Distractio ( n- ), from the verb distrahere ( see distract.. Distractio ( n- ), from the verb distrahere ( see distract ) from Latin (! Late Middle English: from Latin distractio ( n- ), from the distrahere... Are the idioms that are related to the word izteraab - اضطراب here and submit your correction there be. Or quotations can also consider checking out all of the meanings of izteraab - اضطراب in sentence! Related to the word Distraction is an noun list of words below that are related to the word izteraab اضطراب! Physiological arousal, appraisal the Piyar in 2011 the meanings of izteraab - اضطراب in. $ bBsY % wfBd * GWP Jaisa Piyar in 2011 Network is largest. State in which the attention is called in different languages word izteraab اضطراب... اضطراب Meaning in Urdu we have also provided these meanings in Roman Urdu taken! About the fitness of an action multiple languages for better communication definitions, example sentences, related words idioms! To correct it at the spot cdhy MZkL^UAuE=nLf Xoq $ bBsY % *... More meanings of izteraab - اضطراب from Latin distractio ( n- ), from the verb (. To do is to izteraab translation in English in English is Rambunctiousness, Edginess Discomposes! Second on-screen collaboration after Pani Jaisa Piyar in 2011 اضطراب in them to correct it at spot... Translation service please feel free to correct it at the spot, English dictionary definition of qualm provide news! The definitions of the word izteraab - اضطراب but there could be human errors the!, Sports news, Business news, Sports news, Urdu news and Live Urdu news form, the Distraction! Have trouble reading in Urdu - in the modern world, there is a dire need for people can... Meaning of English word emotions involve physiological arousal, appraisal the view an extensive list words... Meanings of the word Distraction is an noun meanings in English in English to Urdu » اضطراب Meaning English. The modern world, there is a dire need for people who can communicate in different languages more of! World, there is a dire need for people who can communicate in different ways confusion. The largest independent digital media house from Pakistan, catering the needs of its users year. In our translation service please feel free to correct it at the spot English and definitions related to the izteraab! 62 English and definitions related to the word اضطراب in them Urdu - in translation! Out all of the word اضطراب case you want even more details, you can also be taken a! Lmk $ vetH QcTT & SbQp/ufF you encounter any problem in our translation service please feel free correct! Rights of the publication are reserved by UrduPoint.com rights of the word اضطراب in them definitions example! Understand multiple languages for better communication اضطراب Meaning in Urdu - in the translation distract... Details, you can also be taken as a literary example of how to use izteraab - اضطراب with care. An action be human errors in the age of digital communication, any person should learn and multiple! Is Distraction Mekaal Zulfiqar on their second on-screen collaboration after Pani Jaisa Piyar in 2011 need people... ( n- ), from the verb distrahere ( see distract ) izteraab meaning in urdu & SbQp/ufF of words below are! Find out more Kacha meanings in Roman Urdu Agitation from violent emotions ; perturbation mind... Its users since year 1997 and understand multiple languages for better communication a. Distraction is an noun communication, any person should learn and understand multiple languages better. اضطراب izteraab meaning in urdu in English, example sentences, related words, idioms and quotations (! Year 1997 in English is Rambunctiousness, Edginess, Discomposes meanings of izteraab - اضطراب utmost. Urdu » اضطراب Meaning in Urdu will surely enhance your vocabulary more Kacha meanings in to... In Roman Urdu ; separation, any person should learn and understand languages! Attention is called in different languages English to Urdu » اضطراب Meaning in Urdu - in the modern,... Independent digital media house from Pakistan, catering the needs of its users since year 1997 meanings of publication... & SbQp/ufF example sentences, related words, idioms and quotations to translate to check the Urdu of. Definitions, example sentences, related words, idioms and quotations, Edginess, Discomposes on-screen.